PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000716457
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 387aa    MW: 42737.9 Da    PI: 7.0799
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000716457genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W + +++ g+ R++k+c++rw +yl
    MDP0000716457 14 KGPWTPEEDQKLLTYIEEHGHGSWQALPAKAGLQRCGKSCRLRWSNYL 61
                     79********************************************97 PP

2Myb_DNA-binding45.12.2e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  +E + +++++++ G++ W++Ia++++ +Rt++++k++w+++l
    MDP0000716457  67 RGNFNLQEAQTIIQLHALVGNR-WSAIASHLP-KRTDNEIKNYWNTHL 112
                      8999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-24563IPR009057Homeodomain-like
PROSITE profilePS5129416.824961IPR017930Myb domain
SuperFamilySSF466892.49E-2911108IPR009057Homeodomain-like
SMARTSM007179.8E-141363IPR001005SANT/Myb domain
PfamPF002492.8E-161461IPR001005SANT/Myb domain
CDDcd001673.34E-111661No hitNo description
PROSITE profilePS5129423.4462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2464116IPR009057Homeodomain-like
SMARTSM007173.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.2E-1367112IPR001005SANT/Myb domain
CDDcd001672.66E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRSPCWEKV GLKKGPWTPE EDQKLLTYIE EHGHGSWQAL PAKAGLQRCG KSCRLRWSNY  60
LRPDIKRGNF NLQEAQTIIQ LHALVGNRWS AIASHLPKRT DNEIKNYWNT HLKKRLTKMG  120
IDPMTHKLKH HEGYAKDSAN ISHMAQWESA RLEAEARLGK ESKLVITNAN PFQHHLMICS  180
SPNPAHQVVH VSNAPPALPC LDVLKAWREG CSLTTNSTIR NNVNSIMFSG GSMTAVDDLE  240
SPTSTLHLRH VNNAFNPPPM LNINNVFPCE SGVLQNNDNV TYGCTDASAA WFADGFRSGN  300
VDEEENVVVP AELSSKVMEG FTDVLVYDSE DHQQNALLGG EISGNGGDDG SCGGRGFEEN  360
RNYWNSILNL VNASASGSPV FGRFRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350919.10.0PREDICTED: transcription factor MYB28-like
TrEMBLW9S8D01e-132W9S8D0_9R
STRINGPOPTR_0010s17300.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-101myb domain protein 16